IGF-1 LR3 1mg
$69.00
IGF-1
IGF-1 LR3Â (insulin-like growth factor-1 long arginine 3) is a synthetic, modified construct of insulin-like growth factor-1. Because IGF-1 LR3 does not bind to IGF-1 binding proteins very well, it remains active up to 120 times longer than standard IGF-1. This results in improved half-life for the peptide and thus increased activity. IGF-1 LR3 enhances cell division and growth, boosts fat metabolism, and increases muscle repair and hypertrophy by inhibiting myostatin. Recent research suggests that IGF-1 LR3 may also be useful in improving lactation among mothers with young offspring.
**Insulin-like Growth Factor 1 (IGF-1)** is a hormone that plays an important role in growth and development, particularly during childhood and adolescence. It is primarily produced in the liver as a response to stimulation by growth hormone (GH). IGF-1 is essential for cell growth, differentiation, and regeneration.
### Functions of IGF-1:
1. **Growth Promotion**: IGF-1 mediates many of the growth-promoting effects of growth hormone. It influences the growth of bones, cartilage, and various tissues.
2. **Cellular Development**: IGF-1 promotes cellular proliferation and inhibits apoptosis (programmed cell death), which is crucial for tissue growth and repair.
3. **Metabolic Role**: IGF-1 has insulin-like effects, such as increasing glucose transport into cells and influencing fat metabolism.
4. **Muscle Growth**: It is also involved in the hypertrophy (growth) of muscle tissue, making it of interest in research on muscle wasting, aging, and exercise performance.
### Clinical Uses of IGF-1:
1. **Growth Hormone Deficiency**: IGF-1 levels are often measured in conjunction with growth hormone to assess growth disorders in children. It may be supplemented in cases of severe IGF-1 deficiency leading to growth failure.
2. **Laron Syndrome**: This is a condition resulting from a genetic mutation that causes insensitivity to growth hormone, leading to low IGF-1 levels. Treatment with IGF-1 can help promote growth in affected individuals.
3. **Potential Uses in Aging and Muscle Wasting**: Due to its role in muscle development and repair, IGF-1 is being studied for potential applications in combating age-related muscle loss (sarcopenia) and conditions resulting in muscle atrophy, such as cachexia.
### IGF-1 and Performance Enhancement:
IGF-1 is sometimes used illegally in sports and bodybuilding to enhance performance, promote muscle gain, and reduce fat. However, this practice is associated with health risks and is banned by most sports organizations.
### Side Effects and Risks:
While IGF-1 has beneficial roles in growth and metabolism, misuse or excessive levels can lead to various health issues:
– **Joint and Muscle Pain**: Excessive IGF-1 can cause overgrowth of tissues, leading to pain and discomfort.
– **Insulin Resistance**: Elevated IGF-1 levels can contribute to insulin resistance, increasing the risk of type 2 diabetes.
– **Increased Risk of Tumors**: There is ongoing research examining the relationship between high IGF-1 levels and certain cancers, as IGF-1 can promote cell proliferation.
### Measurement and Regulation:
IGF-1 levels can be measured through a blood test, and they follow a diurnal rhythm, meaning levels vary throughout the day and can be influenced by many factors, including nutrition, exercise, and overall health.
### Conclusion:
IGF-1 is a crucial hormone involved in growth and metabolism. While it can have positive effects on growth and muscle development, both in medical contexts and potentially in sports, it is important to use it under proper medical supervision due to possible side effects and health risks. Any supplementation or treatment involving IGF-1 should be approached carefully and discussed with a healthcare professional.
IGF-1
IGF LR3 (Long arginine 3-IGF-1) 1mg – High-Quality Research Peptide
Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name:Â IGF LR3 1mg
- Catalogue Number:Â IGF1LR3-1mg
- Molecular Weight:Â 9117.60 gmol
- Purity: ≥98%
- Sequence:Â MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Form:Â Lyophilised Solid
Usage and Storage:
Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.
If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.


MAECENAS IACULIS
Vestibulum curae torquent diam diam commodo parturient penatibus nunc dui adipiscing convallis bulum parturient suspendisse parturient a.Parturient in parturient scelerisque nibh lectus quam a natoque adipiscing a vestibulum hendrerit et pharetra fames nunc natoque dui.
ADIPISCING CONVALLIS BULUM
- Vestibulum penatibus nunc dui adipiscing convallis bulum parturient suspendisse.
- Abitur parturient praesent lectus quam a natoque adipiscing a vestibulum hendre.
- Diam parturient dictumst parturient scelerisque nibh lectus.
Scelerisque adipiscing bibendum sem vestibulum et in a a a purus lectus faucibus lobortis tincidunt purus lectus nisl class eros.Condimentum a et ullamcorper dictumst mus et tristique elementum nam inceptos hac parturient scelerisque vestibulum amet elit ut volutpat.
Reviews
There are no reviews yet.